PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Niben101Scf00305g00001.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family ZF-HD
Protein Properties Length: 311aa    MW: 34976.9 Da    PI: 8.2471
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Niben101Scf00305g00001.1genomeBTI-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer106.61.4e-33101157259
               ZF-HD_dimer   2 ekvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRrevee 59 
                               ++vrYkeClkNhAas+Ggh++DGCgEfmps geegt++ lkCaAC+CHRnFHR+e+e+
  Niben101Scf00305g00001.1 101 SSVRYKECLKNHAASMGGHVLDGCGEFMPS-GEEGTPEHLKCAACDCHRNFHRKETED 157
                               579**************************9.999*********************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD1257742.0E-21102156IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PfamPF047702.4E-31103155IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015663.5E-31104154IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152327.418105154IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
SuperFamilySSF466897.53E-17243308IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.607.4E-28243309IPR009057Homeodomain-like
TIGRFAMsTIGR015659.1E-25247304IPR006455Homeodomain, ZF-HD class
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 311 aa     Download sequence    Send to blast
MEHTGQEKDM GMPNSIGFNS SHLNQQESTP FAAAKLPTAP IVSSLPDRTR NEQISYGNTI  60
FSPNQTLDHQ HNLTQNSDPD PTVIAAEIRQ QSTTSASDRN SSVRYKECLK NHAASMGGHV  120
LDGCGEFMPS GEEGTPEHLK CAACDCHRNF HRKETEDKLQ TAGVYRNNSN SHRVHTQTPP  180
SLSAPPQQQH HHKYSHNYSR GPMPPVMMNF GGNTGVPAES SSEDLNMFHL NAGGQGVIQP  240
CAFSASKKRF RTKFTQQQKE KMQEFAEKLE WRIQKQDEQE VQQFCNEVGV KRQVFKVFMH  300
NCKQAIKRKQ T
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wh7_A5e-202483031873ZF-HD homeobox family protein
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009804697.10.0PREDICTED: zinc-finger homeodomain protein 6
SwissprotQ9ZPW71e-66ZHD6_ARATH; Zinc-finger homeodomain protein 6
TrEMBLM0ZVH11e-165M0ZVH1_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000090331e-164(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA51824128
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G18350.19e-68homeobox protein 24